Protein coding transcript 187579

• Transcript: Ll_transcript_159912
• CDS coordinates: 818-1303 (+)
• Peptide sequence: MHDGNTSTVGPTSVDKEALGTETSLKDTAIAIEKKTASPSPSICFQLVCYPCAYICSCSSSNDESSDQQTSEDGMFYCSLCEVEVFKYSKHCRVCDKCVDHFDHHCRWLNNCIGKKNYRQFFTLMVAANLLAYAWFLNFGLETAAYSSMVDWDTCAYLLFC*
• ORF Type: complete

Annotations of Ll_transcript_159912

• Blastp: Probable protein S-acyltransferase 22 from Arabidopsis with 67.54% of identity
• Blastx: Probable protein S-acyltransferase 22 from Arabidopsis with 75.94% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT1G69420)
• CantataDB: Link to cantataDB annotations (CNT0002609)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433396.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;