Protein coding transcript 18758

• Transcript: Ll_transcript_392957
• CDS coordinates: 1167-1514 (+)
• Peptide sequence: MLLVIQILHKRAIEASEKERATPDIRTGDIVEIKLEVPENKRRLSIYKGIVISRQNSGIHTTIRIRRIIAGVGVEIVFPIYSPNIKQIKVVSHRKVRRARLYYLRDKLPRLSTFK*
• ORF Type: complete

Annotations of Ll_transcript_392957

• Blastp: 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 36.36% of identity
• Blastx: 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 86.61% of identity
• Eggnog: This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site (By similarity)(COG0335)
• Kegg: Link to kegg annotations (AT4G17560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421813.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;