Protein coding transcript 187593

• Transcript: Ll_transcript_160140
• CDS coordinates: 59-385 (+)
• Peptide sequence: MGRAPCCEKGGLKKGKWTAEEDEILTKYIQVNGEGSWRSLPKNAGLLRCGKSCRLRWINYLRSDLKRGNISVEEDSLIVELHASFGNRWSLIASHLPGRTDNDIKNYWN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_160140

• Blastp: Transcription factor MYB111 from Arabidopsis with 83.49% of identity
• Blastx: Transcription factor MYB111 from Arabidopsis with 83.49% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G49330)
• CantataDB: Link to cantataDB annotations (CNT0002398)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430693.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;