Protein coding transcript 18761

• Transcript: Ll_transcript_392961
• CDS coordinates: 325-879 (+)
• Peptide sequence: MQAVALRVNSNRAMFYRVMIKGTQDTLLDNSGTHYFFRCLIQGKVDFIFGNAKSLYEQCHLQSIAENYGAIAAHHRNSPHQDTGFSFVGCRIRGTGNVYLGRAWGDYSRIIYSNTYMDDIINPAGWSEWNHPERKWTAVFGEYECEGRGADRRHRVPWSKSFSYEEAKPFLDKRFIDGDQWLRL*
• ORF Type: complete

Annotations of Ll_transcript_392961

• Blastp: Pectinesterase QRT1 from Arabidopsis with 63.93% of identity
• Blastx: Pectinesterase QRT1 from Arabidopsis with 61.34% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G55590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456029.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;