Protein coding transcript 187617

• Transcript: Ll_transcript_158893
• CDS coordinates: 214-582 (+)
• Peptide sequence: MSTSAAVDPHDKMRARDVNKVARGEQAPRPAHEYGTVSPPPPPSSTQQHTHTNTNNEDSELRGSSYQTCYVKYVEYHRCINQKGEKAPECNKLDTYVRSSCPTQWIAEWDRDRLDGKFPEAI*
• ORF Type: complete

Annotations of Ll_transcript_158893

• Blastp: Putative cytochrome c oxidase subunit 6b-like from Arabidopsis with 42.86% of identity
• Blastx: Putative cytochrome c oxidase subunit 6b-like from Arabidopsis with 42.86% of identity
• Eggnog: cytochrome C oxidase(ENOG41121WM)
• Kegg: Link to kegg annotations (AT1G32710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423141.1)
• Pfam: Cytochrome oxidase c subunit VIb (PF02297.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;