Protein coding transcript 187650

• Transcript: Ll_transcript_158777
• CDS coordinates: 332-844 (+)
• Peptide sequence: MEFCAISCCFIDSLLLPSDTIFVRVYESRMDLLRAVIIGAEGTPYHDGLFFFDVFFPSAYPKVPPQVHYHSGGLRLNPNLYHCGKVCLSLLNTWSGSKDEKWVPGVSTILQVLVSIQGLILNMKPYFNEPGYERTSGTKQGESSSLKYNEDTFILSLRTMVYMMRKPPKV*
• ORF Type: complete

Annotations of Ll_transcript_158777

• Blastp: Probable ubiquitin-conjugating enzyme E2 25 from Arabidopsis with 77.48% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 25 from Arabidopsis with 77.48% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XP8C)
• Kegg: Link to kegg annotations (AT3G15355)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443954.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;