Protein coding transcript 18768

• Transcript: Ll_transcript_392949
• CDS coordinates: 81-434 (+)
• Peptide sequence: MLMASSQLLLQQFAIPQYSNLCSPPIAKLSFVSSCSTSRNIPFTSISWSHSVQKHKPHFVVRAESQPQETTENVEEEEEEKEEQVSEPKPARQPRVKLGDIMGVVFSSHFLISFILA*
• ORF Type: complete

Annotations of Ll_transcript_392949

• Blastp: 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 36.36% of identity
• Blastx: 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 80.52% of identity
• Eggnog: This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site (By similarity)(COG0335)
• Kegg: Link to kegg annotations (AT4G17560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421814.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;