Transcript | Ll_transcript_392949 |
---|---|
CDS coordinates | 81-434 (+) |
Peptide sequence | MLMASSQLLLQQFAIPQYSNLCSPPIAKLSFVSSCSTSRNIPFTSISWSHSVQKHKPHFVVRAESQPQETTENVEEEEEEKEEQVSEPKPARQPRVKLGDIMGVVFSSHFLISFILA* |
ORF Type | complete |
Blastp | 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 36.36% of identity |
---|---|
Blastx | 50S ribosomal protein L19-1, chloroplastic from Arabidopsis with 80.52% of identity |
Eggnog | This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site (By similarity)(COG0335) |
Kegg | Link to kegg annotations (AT4G17560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421814.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer