Transcript | Ll_transcript_392944 |
---|---|
CDS coordinates | 1013-2089 (+) |
Peptide sequence | MSRIKCILRGLDLKTFIFIFVVVPMSILGLYVHGQKITYFLRPLWESPPKPFHEIPHYYHENVSMQTLCKLHGWGIRESPRRVFDAVLFNNEVDLLTIRWNEMHPFVTQYVLLESNSTFTGIVKPLFYANNRDQFKFVESRLTYGLIGGRFKKHENPFVEEAYQRVALDQLLRIAGIEDDDLLIMSDVDEIPSAHTINLLRWCDDIPPVLHLQLRNYLYSFEFFQDTESWRASMHRYQTGKTRYAHYRQSDVLLSDAGWHCSFCFRYISDFIFKMKAYSHNDRIRFAHYLNPDRIQDVICKGADLFDMLPEEYTFKEIIGKMGPIPHSYSAVHLPAYLLNNADKYRFLLPGNCKRKSD* |
ORF Type | complete |
Blastp | Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase from Rattus with 27.8% of identity |
---|---|
Blastx | Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase from Rattus with 27.8% of identity |
Eggnog | Glycosyl transferase family 17 protein(ENOG410YQKP) |
Kegg | Link to kegg annotations (29582) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447452.1) |
Pfam | Glycosyltransferase family 17 (PF04724.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer