Transcript | Ll_transcript_94735 |
---|---|
CDS coordinates | 118-732 (+) |
Peptide sequence | MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRQERGSDVIIVLVGNKTDLVDKRQVSIEEGDAKSRDFGIMFIETSAKAGFNIKPLFRKIAAALPGMETLSSTKQEDMVDVNLKPTVNSSNSEQQGGGC |
ORF Type | 3prime_partial |
Blastp | Ras-related protein RABH1e from Arabidopsis with 92.68% of identity |
---|---|
Blastx | Ras-related protein RABH1e from Arabidopsis with 92.68% of identity |
Eggnog | member RAS oncogene family(ENOG410XPBI) |
Kegg | Link to kegg annotations (AT5G10260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459760.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer