| Transcript | Ll_transcript_94748 |
|---|---|
| CDS coordinates | 996-1406 (+) |
| Peptide sequence | MCKTASMHEIEEFTWDFVCLFFCRVACSYPNKNITFKIDESSGNPHYLAFVIRYQQGRRDITAVQLCETQNFVCKLLDRSHGAVWSTTSAPSGPLSVRMLFSDEEGGEENWVVPVNDIPQDWKAGDIYDSGVQVNQ* |
| ORF Type | complete |
| Blastp | Expansin-like B1 from Oryza sativa with 60.16% of identity |
|---|---|
| Blastx | Expansin-like B1 from Oryza sativa with 46.32% of identity |
| Eggnog | expansin-like(ENOG410Y95B) |
| Kegg | Link to kegg annotations (9269361) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423137.1) |
| Pfam | Pollen allergen (PF01357.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer