Protein coding transcript 187865

• Transcript: Ll_transcript_93060
• CDS coordinates: 2-316 (+)
• Peptide sequence: NDHIVNLIAQNRQVILPIIFPALDSNVHSHWNPAVMNLTHNVRKMFLEIDEKLYISCHSHFKEDETILSAEAEKRKEAWKQLERAASLKPVTGNTAVLVSPLMT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_93060

• Blastp: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 63.46% of identity
• Blastx: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 63.55% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XQJW)
• Kegg: Link to kegg annotations (AT5G25510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447528.1)
• Pfam: Protein phosphatase 2A regulatory B subunit (B56 family) (PF01603.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;