| Transcript | Ll_transcript_92320 |
|---|---|
| CDS coordinates | 2189-2494 (+) |
| Peptide sequence | MHVCVQITYSIPFALASIFSITSGAGQGLSLGVLNLAIVIPQMIVSVLSGPWDDAFGGGNLPAFVVGAVAAAASGILSIVLLPSPPPELAKAATATGGGFH* |
| ORF Type | complete |
| Blastp | Sucrose transport protein from Spinacia with 78.26% of identity |
|---|---|
| Blastx | Sucrose transport protein SUC2 from Arabidopsis with 68.45% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0002502) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452732.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer