Transcript | Ll_transcript_92561 |
---|---|
CDS coordinates | 168-548 (+) |
Peptide sequence | MRHQKQLLNTNRRPTILYLVFAVSIFSLFLFAIQSSFFSGSINSHRNAETIRILSQFQSNLQQCVANRGLGLTAHIVDHCKLILKYPEGTNSTWYNAQFKKFEPLEYNYDMCETLLLWEQVDHHSF* |
ORF Type | complete |
Blastp | Sialyltransferase-like protein 1 from Arabidopsis with 61.4% of identity |
---|---|
Blastx | Sialyltransferase-like protein 1 from Arabidopsis with 61.4% of identity |
Eggnog | ST3 beta-galactoside alpha-2,3-sialyltransferase(ENOG410XT8P) |
Kegg | Link to kegg annotations (AT1G08660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457242.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer