Protein coding transcript 187950

• Transcript: Ll_transcript_94462
• CDS coordinates: 216-917 (+)
• Peptide sequence: MRIVGLTGGISSGKSTVSNLFKSHGIPIVDADIVARDALKKGSGGWKKVVAAFGEEILLDNGEVNRPKLGQIVFSDPDKRQFLNRLLAPYISSGIFWEILKLWLKGYKVIVLDVPLLFEAKMNKFTKPIIVVWVDPEQQIQRLMARDKSSEEDARNRINAQMPLDVKRSKADIVIDNTGSLDDLNQHFQKVLLEVSKPLTWTQFWLSRQGAFIILTSVTSGVLLRIKAFNNTS*
• ORF Type: complete

Annotations of Ll_transcript_94462

• Blastp: Dephospho-CoA kinase from Arabidopsis with 75.23% of identity
• Blastx: Dephospho-CoA kinase from Arabidopsis with 75.23% of identity
• Eggnog: Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A (By similarity)(COG0237)
• Kegg: Link to kegg annotations (AT2G27490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421611.1)
• Pfam: Dephospho-CoA kinase (PF01121.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;