Transcript | Ll_transcript_94459 |
---|---|
CDS coordinates | 216-917 (+) |
Peptide sequence | MRIVGLTGGISSGKSTVSNLFKSHGIPIVDADIVARDALKKGSGGWKKVVAAFGEEILLDNGEVNRPKLGQIVFSDPDKRQFLNRLLAPYISSGIFWEILKLWLKGYKVIVLDVPLLFEAKMNKFTKPIIVVWVDPEQQIQRLMARDKSSEEDARNRINAQMPLDVKRSKADIVIDNTGSLDDLNQHFQKVLLEVSKPLTWTQFWLSRQGAFIILTSVTSGVLLRIKAFNNTS* |
ORF Type | complete |
Blastp | Dephospho-CoA kinase from Arabidopsis with 75.23% of identity |
---|---|
Blastx | Dephospho-CoA kinase from Arabidopsis with 75.23% of identity |
Eggnog | Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A (By similarity)(COG0237) |
Kegg | Link to kegg annotations (AT2G27490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421611.1) |
Pfam | Dephospho-CoA kinase (PF01121.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer