Protein coding transcript 188001

• Transcript: Ll_transcript_91912
• CDS coordinates: 2-361 (+)
• Peptide sequence: STLPLRIRYLQKFHFLLPIPMALSKLLVASILASLLLLHLVDAAQSVHSQMHGSLLQQIDCNGACTARCRLSSRPRLCQRACGTCCRRCNCVPPGTAGNQKLCPCYASLTTHGGTRKCP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_91912

• Blastp: Snakin-2 from Solanum with 63.46% of identity
• Blastx: Snakin-2 from Solanum with 79.69% of identity
• Eggnog: gast1 protein homolog 1(ENOG410YWQ9)
• Kegg: Link to kegg annotations (102582131)
• CantataDB: Link to cantataDB annotations (CNT0001808)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433680.1)
• Pfam: Gibberellin regulated protein (PF02704.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;