Protein coding transcript 188136

• Transcript: Ll_transcript_93220
• CDS coordinates: 1970-2974 (+)
• Peptide sequence: MDPTDGWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFASSDGTPYLQSNMICVFESYAGDIAWRHSECPITNLKVTEVRPKVTLVVRMAAAVANYDYIMDWEFQTDGLIRAKVGLSGILMVKGTTYDNMNQVPNQEYLYGTLLSENIIGVIHDHYVTYYLDMDIDGSNNSFVKVNIKKQETSEGESPRKSYLKAVRNVAKTEKDAQIKLSLYDPSEFHVINPSKKSRLGNPAGYKLVPGATAASLLDHEDPPQKRAAFTNNQIWVTPYNKSEQWAGGLFVYQSKGDDTLQVWSNRLETLFKFLPFCLDYLGVSAIAVTTITLRAKVT*
• ORF Type: complete

Annotations of Ll_transcript_93220

• Blastp: Primary amine oxidase from Arabidopsis with 68.4% of identity
• Blastx: Primary amine oxidase from Arabidopsis with 69.5% of identity
• Eggnog: amine oxidase(COG3733)
• Kegg: Link to kegg annotations (AT1G62810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437496.1)
• Pfam: Copper amine oxidase, enzyme domain (PF01179.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;