Protein coding transcript 188140

• Transcript: Ll_transcript_93241
• CDS coordinates: 90-995 (+)
• Peptide sequence: MAPLSLSLLLSSPSPLPLLHPHRPIFHRTSAAASATDYVSTSTSASTSNLTPKVVVTRERGKNAKLITALAKHEINCLELPLIDHTRGPDFDRLPSVLSANAFDWIIITSPEAGSVFLEAWRAAGMPHVKIGVVGAGTASIFKEALQSSERSLDVAFTPSKATGVTLAAELPKIGIKPAVLYPASAKASHEIEEGLSSRGFEVTRMNTYTTVPVQHVDQIVLRQALAAPVVTVASPSAIRAWKNLVSDSEWSNSVACIGETTAAMARRLGFRNVYNPTQPGLEGWVESIIEALASYDELLR*
• ORF Type: complete

Annotations of Ll_transcript_93241

• Blastp: Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 68.42% of identity
• Blastx: Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 67.87% of identity
• Eggnog: Uroporphyrinogen-III Synthase(ENOG4111P6K)
• Kegg: Link to kegg annotations (AT2G26540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417779.1)
• Pfam: Uroporphyrinogen-III synthase HemD (PF02602.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;