Transcript | Ll_transcript_93246 |
---|---|
CDS coordinates | 90-944 (+) |
Peptide sequence | MAPLSLSLLLSSPSPLPLLHPHRPIFHRTSAAASATDYVSTSTSASTSNLTPKVVVTRERGKNAKLITALAKHEINCLELPLIDHTRGPDFDRLPSVLSANAFDWIIITSPEAGSVFLEAWRAAGMPHVKIGVVGAGTASIFKEALQSSERSLDVAFTPSKATGVTLAAELPKIGIKPAVLYPASAKASHEIEEGLSSRGFEVTRMNTYTTVPVQHVDQIVLRQALAAPVVTVASPSAIRAWKNLVSDSEWSNSVACIGETTAAMARRLGFRNVYNPTQPGLEG* |
ORF Type | complete |
Blastp | Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 68.51% of identity |
---|---|
Blastx | Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 68.51% of identity |
Eggnog | Uroporphyrinogen-III Synthase(ENOG4111P6K) |
Kegg | Link to kegg annotations (AT2G26540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417779.1) |
Pfam | Uroporphyrinogen-III synthase HemD (PF02602.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer