Protein coding transcript 1882

• Transcript: Ll_transcript_534320
• CDS coordinates: 3-755 (+)
• Peptide sequence: SNNMKLNVSYPATGCQKLFEIVDEHKLRIFYDKRMGAEVEADQLGDEWKGYIVRVAGGNDNQGFPMKQGVLTNGRVRLLLSKGHSCYRPRRQGERKRKSVRGCIVDANLSVLALVIVKKGEQDIPGLTDNSHPRRLGPKRASKIRKLFNLTKEDDVRQYVIKRPLPLKEGSTKQRTKAPKIQRLITPLTLQRKRHRIALKKKRAEKKKEQIRDYTKLLAQRQKEAKARRQEELKRRRSASMRDSKSSAVSG
• ORF Type: internal

Annotations of Ll_transcript_534320

• Blastp: 40S ribosomal protein S6 from Spodoptera with 82.93% of identity
• Blastx: 40S ribosomal protein S6 from Spodoptera with 82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020208947.1)
• Pfam: Ribosomal protein S6e (PF01092.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;