Transcript | Ll_transcript_392814 |
---|---|
CDS coordinates | 853-1257 (+) |
Peptide sequence | MELETLYPPCFMSSSNLFVQESNNNIEWTREENKQFESAIAIYDKDTPDRWLKVAAMIPGKTEFDVIKQYRELEEDVTEIEAGRVPIPGYIASSFTFELVSNQNYDGCRKRAATVGGSDQERKKGVPWTEEEHR* |
ORF Type | complete |
Blastp | Transcription factor DIVARICATA from Antirrhinum with 51.43% of identity |
---|---|
Blastx | Transcription factor DIVARICATA from Antirrhinum with 51.43% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454444.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer