Protein coding transcript 18824

• Transcript: Ll_transcript_392828
• CDS coordinates: 471-1373 (+)
• Peptide sequence: MELGTLYPPCFMSSSNWCMQDINNNNDDYTEWSIEENKQFESALAIYDKDTPDRWLKVAAMIPGKTVFDVIKQYKDLEEDLSEIEAGRVPIPCYITSAFTFELISNQNYEGCRKRAATIRGSDQEKKKGVPWTEEEHRRFLMGLMKYGKGDWRNIARNFVVTKTPTQVASHAQKYYIRQKDSGVKDKRRPSIHDITTVNLTETVTSDKNNPLLFNESLMLEPQQKLSTSMSKVQLEWINHNNDGSLMVFNPNCDDLLKVQEQDLNDCAFHEAYAKLQIPSFTTASRDFNKEAVFGIHALS*
• ORF Type: complete

Annotations of Ll_transcript_392828

• Blastp: Transcription factor DIVARICATA from Antirrhinum with 48.75% of identity
• Blastx: Transcription factor DIVARICATA from Antirrhinum with 48.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454444.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;