Protein coding transcript 188287

• Transcript: Ll_transcript_92602
• CDS coordinates: 4959-5333 (+)
• Peptide sequence: MIFNDSARGKTCHQCRHKITCLAASCKNLKENGKACPLNFCQKCLLNRYEGEAQTVEPLSRWICPKCRGKCSCSCCMGKQGLKPIGRLVKKGKALGSNSVEDMALGSKTVENMALGSNSVEDMAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_92602

• Blastp: Cell division cycle-associated 7-like protein from Mus with 36.73% of identity
• Blastx: Copia protein from Sophophora with 28.57% of identity
• Eggnog: Cell division cycle associated 7-like(ENOG410XQV7)
• Kegg: Link to kegg annotations (217946)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020982505.1)
• Pfam: Zinc-finger domain of monoamine-oxidase A repressor R1 (PF10497.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;