Transcript | Ll_transcript_92607 |
---|---|
CDS coordinates | 6131-6505 (+) |
Peptide sequence | MIFNDSARGKTCHQCRHKITCLAASCKNLKENGKACPLNFCQKCLLNRYEGEAQTVEPLSRWICPKCRGKCSCSCCMGKQGLKPIGRLVKKGKALGSNSVEDMALGSKTVENMALGSNSVEDMAL |
ORF Type | 3prime_partial |
Blastp | Cell division cycle-associated 7-like protein from Mus with 36.73% of identity |
---|---|
Blastx | Copia protein from Sophophora with 28.57% of identity |
Eggnog | Cell division cycle associated 7-like(ENOG410XQV7) |
Kegg | Link to kegg annotations (217946) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020982505.1) |
Pfam | Zinc-finger domain of monoamine-oxidase A repressor R1 (PF10497.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer