Transcript | Ll_transcript_92196 |
---|---|
CDS coordinates | 78-974 (+) |
Peptide sequence | MPYCDIGTLESPSPSFSAASVVSDDSQLNNDLKIFYRTYGRGPTKVLLIIGLAATHDSWGPQVIGLTGTDVPNNDTCSGDGDDDNECGGGIQACAFDNRGVGRSSAPVNKSDYSTQIMAKDAIALLDHLGWKKAHVFGHSMGAMIACKVAAMVPDRVLSLALLNVTGGGFECFPKLDRQTVSVAYRFLKAKTPEQRAAVDLDTHYSQEYLEEYVGTDKRRTILYQQYVKGISASGMQSNYGFEGQLNACWTHKISQTEIEVIQSAGFLISVIHGRHDIIAQIYYAKNLLRGFNLWREW* |
ORF Type | complete |
Blastp | Putative aminoacrylate hydrolase RutD from Methylobacterium with 29.51% of identity |
---|---|
Blastx | Putative aminoacrylate hydrolase RutD from Methylobacterium with 30.77% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (Mchl_2054) |
CantataDB | Link to cantataDB annotations (CNT0001750) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434641.1) |
Pfam | Alpha/beta hydrolase family (PF12697.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer