Protein coding transcript 188334

• Transcript: Ll_transcript_92200
• CDS coordinates: 1477-1995 (+)
• Peptide sequence: MAKDAIALLDHLGWKKAHVFGHSMGAMIACKVAAMVPDRVLSLALLNVTGGGFECFPKLDRQTVSVAYRFLKAKTPEQRAAVDLDTHYSQEYLEEYVGTDKRRTILYQQYVKGISASGMQSNYGFEGQLNACWTHKISQTEIEVIQSAGFLISVIHGRHDIIAQIYYAKKIC*
• ORF Type: complete

Annotations of Ll_transcript_92200

• Blastp: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system from Pseudomonas with 46.15% of identity
• Blastx: -
• Eggnog: Dehydrogenase(COG0508)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001750)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434641.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;