Protein coding transcript 188335

• Transcript: Ll_transcript_92189
• CDS coordinates: 115-1083 (+)
• Peptide sequence: MSQQQNSNIPVSEVFWTLADKADKKFSNIRDLPYYQRTRHDTYFYKVFKVYTQLWKFQQENRQKLVEAGLKRWEIGEIASRIGQLYFGQYMRTSEANYLSESYIFYEAILTREYFKEGLFQDVNIANKQLRFLARFLMVCLVLNRREMVQQLVNQLQVLVSECKRTFQESDFKEWKVVVQEIVRFLKADTAFMNIRPLRYSLVLDPHPDTLPNVSAAITKRNLKLRDAVLTSFHHNEVKFSELTIDTFRMLQCLEWEPSGLFYQSTGSKLSHNGATGATRINYSQDIADPTLPTNPRKAVLYRPSLTHFIAVSMRRYMFCFC*
• ORF Type: complete

Annotations of Ll_transcript_92189

• Blastp: Protein SCAI from Mus with 39.61% of identity
• Blastx: Protein SCAI from Homo with 39.61% of identity
• Eggnog: negative regulation of Rho protein signal transduction(ENOG410XRRG)
• Kegg: Link to kegg annotations (320271)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463349.1)
• Pfam: Protein SCAI (PF12070.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;