Protein coding transcript 188449

• Transcript: Ll_transcript_94116
• CDS coordinates: 64-1134 (+)
• Peptide sequence: MALPSAIFTTPIPTLPPFSSYPKFHSPKFKYQFSTTSTLNHQNIVSKLNTQQNEQHLKVQTRTWNWKGYSIRYQYSGNHGPALVLIHGFGANSDHWRKNISVLAESHRVYSIDLIGYGYSDKPNPREIGDGSFYTFETWATQLNEFCLDVVKDEAFFICNSIGGVVGLQAAVIAPKICRGILLLNISLRMLHITKQPWFAKPFIKSFQRLLRDTAAGKFFFKAVATKESVRNILSQCYHDTSKVTDELVQVILSPGLEPGAAEVFLEFICYSGGPLPEDLLPLVKCPVLIGWGDKDPWEPIEMGRNYSTFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVARHAKSSSTTSTIN*
• ORF Type: complete

Annotations of Ll_transcript_94116

• Blastp: Pheophytinase, chloroplastic from Arabidopsis with 25% of identity
• Blastx: Pheophytinase, chloroplastic from Arabidopsis with 24.75% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (AT5G13800)
• CantataDB: Link to cantataDB annotations (CNT0002824)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430627.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;