Protein coding transcript 188458

• Transcript: Ll_transcript_94112
• CDS coordinates: 221-778 (+)
• Peptide sequence: MNNTSRFKHGNFILFFSFNTWNYIYLYTFLLCRTWNWKGYSIRYQYSGNHGPALVLIHGFGANSDHWRKNISVLAESHRVYSIDLIGYGYSDKPNPREIGDGSFYTFETWATQLNEFCLDVVKDEAFFICNSIGGVVGLQAAVIAPKICRGILLLNISLRMLHITKQPWFAKPFIKSFQRLLRYK*
• ORF Type: complete

Annotations of Ll_transcript_94112

• Blastp: Haloacetate dehalogenase H-1 from Moraxella with 33.06% of identity
• Blastx: Haloacetate dehalogenase H-1 from Moraxella with 33.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002824)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430627.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;