Protein coding transcript 188460

• Transcript: Ll_transcript_94139
• CDS coordinates: 2-475 (+)
• Peptide sequence: NPSTSKTNPSEKYIQIMSDDNHEFWFMGFVHYDNVVQSIQETLLASLFQNRLHLELVYAMEVDEKCDVFSFGVLSLEIIIARHPGDLISSLFSSSTTSKASNSLLKNVLDRRLPHPVMPIVKEVILVAKPTFPCLSQSPPSRPSMEHVYGEFVMPRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_94139

• Blastp: MDIS1-interacting receptor like kinase 2 from Arabidopsis with 47.96% of identity
• Blastx: MDIS1-interacting receptor like kinase 2 from Arabidopsis with 42.86% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G08850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014622139.1)
• Pfam: GRAM domain (PF02893.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;