Transcript | Ll_transcript_534339 |
---|---|
CDS coordinates | 2-598 (+) |
Peptide sequence | RIASFLYWDGMRSDIRTYIEQCDVCQRNKYSTLAPAGLLQPLPIPQQVWSDISMDFVGGLPRVKGKDTIYVVVDRLPKYAHFFAIGHPYSAKDVAAVFIQGVVKLHGFPTTIVSDRDPLFLSHFWKELFKMAGSQLKLSTSYHPQTDSQTEVTNRCLETYLRCFVGPKPEQWVEWCPSFLVKLLVSLKNKLTNYTNIT* |
ORF Type | 5prime_partial |
Blastp | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 38.32% of identity |
---|---|
Blastx | Transposon Tf2-9 polyprotein from Schizosaccharomyces with 38.32% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC13D1.01c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015964281.2) |
Pfam | Integrase core domain (PF00665.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer