Protein coding transcript 188554

• Transcript: Ll_transcript_92652
• CDS coordinates: 929-1339 (+)
• Peptide sequence: MDERNNLSMSDPDLVPLLIQENYINYRPSGAGKDDSGITRMNLIAHAAESIADGDIVNVQIRRYQQWQLSQTSSVVSCIIPASLLHGQREILEQGERNFNRFGGWLGKNSTRGKNMRLLDDLHGHILASRETSPGR*
• ORF Type: complete

Annotations of Ll_transcript_92652

• Blastp: Replication factor C subunit 1 from Arabidopsis with 77.21% of identity
• Blastx: Replication factor C subunit 1 from Arabidopsis with 76.19% of identity
• Eggnog: replication factor c(COG5275)
• Kegg: Link to kegg annotations (AT5G22010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413096.1)
• Pfam: Replication factor RFC1 C terminal domain (PF08519.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;