Protein coding transcript 188608

• Transcript: Ll_transcript_92891
• CDS coordinates: 750-1220 (+)
• Peptide sequence: MSTFSGLVNLAKLDLERCPGIHGGLVHLQGLTKLESLNLKWCNCVTDGDMKPLSELASLKSLEISCSKVTDFGISFLKGLQKLALLNLEGCLVTAACLDYLTELSALSTLNLNRCNLSDVGCEKFARLENLKVLNLGFNDITDACLAHLKGLTKLES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_92891

• Blastp: Internalin-A from Listeria with 38.16% of identity
• Blastx: Internalin-A from Listeria with 36.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (LMRG_00126)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456694.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;