Protein coding transcript 188631

• Transcript: Ll_transcript_92904
• CDS coordinates: 419-760 (+)
• Peptide sequence: MKLEKHKNLREESSFFWREINNGTLRFDRKDFEVEALRQLSHQELIDFFDEYVKVGAPQKRTLSVGVYGKLHSSEYKAEASQPHLTEIDNIFSFRRSQSLYPSFKGLSGHVKL*
• ORF Type: complete

Annotations of Ll_transcript_92904

• Blastp: Insulin-degrading enzyme-like 1, peroxisomal from Arabidopsis with 58.62% of identity
• Blastx: Insulin-degrading enzyme-like 1, peroxisomal from Arabidopsis with 58.44% of identity
• Eggnog: metalloendopeptidase activity(COG1025)
• Kegg: Link to kegg annotations (AT2G41790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434155.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;