Protein coding transcript 188727

• Transcript: Ll_transcript_93526
• CDS coordinates: 346-1257 (+)
• Peptide sequence: MYSYLGLFLCILFVCCSATPLSLIGSRRSILREVRGNDKSGHPDYAVELNATNFDDILKDTPSTYAVVEFFAHWCPACRNYKPHYEKVARLFNGPDAVHPGLILMTRVDCASKINNKLCDKFSVGHYPMLFWGHPPKFVGGSWEPDQKKSDIHVIKDAYSADLLLNWINKQLDSSFGLDDQKFENEHLSSNISDPGQIAKGIYDVEEATSTAFGIILEHKMIKPETRASLIKFLQLLVAHHPSRRCRKGSAELLVSFDDLYPTDHWSINEQETDKGSVSNLKICGKDVPRGYWVRSQYSYLTF*
• ORF Type: complete

Annotations of Ll_transcript_93526

• Blastp: Sulfhydryl oxidase 2 from Arabidopsis with 63.7% of identity
• Blastx: Sulfhydryl oxidase 2 from Arabidopsis with 63.7% of identity
• Eggnog: Quiescin Q6 sulfhydryl oxidase(ENOG410XVJT)
• Kegg: Link to kegg annotations (AT2G01270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441452.1)
• Pfam: OST3 / OST6 family, transporter family (PF04756.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;