Protein coding transcript 188731

• Transcript: Ll_transcript_93531
• CDS coordinates: 329-1066 (+)
• Peptide sequence: MFSYLGLFLFILFVCSSATPCSLNGSRRSILREVSDNDKNDHPDYAVELNSTNFDVVLKDTPANYAVVEFFAHWCPACRNYKPHYEKVARLFNGPDAVHPGIILMTRVDCALKINNKLCDKFSVGHYPMLFWGHPSKFVGASWEPKQEKSDLRVIDDARTADLLLNWINVKLGSSYGLDDSKFDNEYLASNISDPGQIVKAIYDVEEATSTAFGIILEHKMIKPETRASLIKFLQLLVAHHPSRK*
• ORF Type: complete

Annotations of Ll_transcript_93531

• Blastp: Sulfhydryl oxidase 2 from Arabidopsis with 68.31% of identity
• Blastx: Sulfhydryl oxidase 2 from Arabidopsis with 68.31% of identity
• Eggnog: Quiescin Q6 sulfhydryl oxidase(ENOG410XVJT)
• Kegg: Link to kegg annotations (AT2G01270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426512.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;