Protein coding transcript 188737

• Transcript: Ll_transcript_93518
• CDS coordinates: 1005-1973 (+)
• Peptide sequence: MHGFGKIAKGIYDVEEATSTAFGIILEHKMIKPETRASLIKFLQLLVAHHPSRRCRKGSAELLVSFDDLYPTDHWSINEQETDKGSVSNLKICGKDVPRGYWMFCRGSKNDTRGFSCGLWVLLHSLSVKIEDGESQFAFNATCDFIHNFFICEECRQHFYEMCSSVSITFNKARDYALWLWSTHNKVNERLSKDEASLGTGDPKFPKTIWPPKQLCPSCYLGHDHKSNKIEWKQDEVYKFLTNYYGKTLPSLYKDKKIVGNDGADGAVKDLVVEASNAIVVPLGAALAIAVASCAFGGLAYYWRSQQKNRKYFHHLHSLKNI*
• ORF Type: complete

Annotations of Ll_transcript_93518

• Blastp: Sulfhydryl oxidase 1 from Arabidopsis with 65.93% of identity
• Blastx: Sulfhydryl oxidase 1 from Arabidopsis with 65.93% of identity
• Eggnog: Quiescin Q6 sulfhydryl oxidase(ENOG410XVJT)
• Kegg: Link to kegg annotations (AT1G15020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441452.1)
• Pfam: Erv1 / Alr family (PF04777.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;