Transcript | Ll_transcript_91677 |
---|---|
CDS coordinates | 38-1108 (+) |
Peptide sequence | MAQRSLLLLLFCAVVVAAASGSSFNDFNPIRLVSEGLRDVEAQVLDIIGQSRHAVSFARFVHSYEKRYESSDEMKQRFQIFSDNLKRIRSINKKRLSYTLGVNRFSDWTWEEFKTHRLGAAQNCSATLKGNHKITDAILPEHKDWRKEGIVSPVKDQGQCGSCWTFSTTGALEAAYAQAFGRNISLSEQQLVDCAGAFSNFGCDGGLPSQAFEYIKYNGGLDTEKAYPYTASNGLCKFSAENVGVRVLDSVNITLGAEDELKHAVAFVRPVSVAFQVVDDFQSYKKGVYTSHICGNTPLDVNHAVLAVGYGVENGVPYWLIKNSWGAEWGDNGYFKMEMGKNMCGVSTCASYPVVA* |
ORF Type | complete |
Blastp | Thiol protease aleurain-like from Arabidopsis with 72.44% of identity |
---|---|
Blastx | Thiol protease aleurain from Arabidopsis with 75.98% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (AT3G45310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455184.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer