Protein coding transcript 188884

• Transcript: Ll_transcript_91705
• CDS coordinates: 1937-2644 (+)
• Peptide sequence: MGSLLAGAKFRGDFEERLKAVLKEVTASNGQIILFIDEIHTVVGAGATSGAMDAGNLLKPMLGRGELRCIGATTLNEYRKYIEKDPALERRFQQVFCCQPSVEDTISILRGLRERYELHHGVRISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPTELDEIDRSILKLEMEKLSLKNDTDKASKERLSKLESDLNLLKQKQKELAGQWDSEKALMTRIRSIKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_91705

• Blastp: Chaperone protein ClpB4, mitochondrial from Arabidopsis with 88.56% of identity
• Blastx: Chaperone protein ClpB4, mitochondrial from Arabidopsis with 88.8% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT2G25140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437789.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;