Transcript | Ll_transcript_276051 |
---|---|
CDS coordinates | 73-558 (+) |
Peptide sequence | MPRQSRGAASAPKRPSVPTPQARSAPQQTRQASTVAQPPATQHAPPPAAPQQAAPAASGGSGLFGQMASTAAGVAVGSSIGHAVGGWFGGGSSAAAAPVDQPLAQNENGQTTMNSQYQAPGVCGQDVTNFRSCMDQNQGDLTICGWYLDQLKSCQAAASKY* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Mitochondrial intermembrane space cysteine motif-containing protein MIX17 from Saccharomyces with 44.64% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YMR002W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | - |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer