Protein coding transcript 188970

• Transcript: Ll_transcript_94358
• CDS coordinates: 1274-1804 (+)
• Peptide sequence: MNFAVNVLGTYAMTELMVPLLEKASPDARVITVSSGGMYSTPLTKDLQYSENFDGAEQYARNKRIQVALTETWADKYKNKGIGFYSMHPGWADTPGVAKSLPSFSKSLSGKLRTSEEGADTVIWLALQPKEKLVSGAFYFDRAEAHKHLASAVTRGSHALINSVVDNLNSMASLFV*
• ORF Type: complete

Annotations of Ll_transcript_94358

• Blastp: Dehydrogenase/reductase SDR family member 12 from Bos with 50.93% of identity
• Blastx: Dehydrogenase/reductase SDR family member 12 from Bos with 49.72% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (507276)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439377.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;