| Transcript | Ll_transcript_276000 |
|---|---|
| CDS coordinates | 14-484 (+) |
| Peptide sequence | MKIGLCSYSGYKIYPGHGKTLVKADGKTFTFLNAKCESSHLMKRNPRNVTWTVLYRRKHKKGQEEEHAKKRTRRTQKFQRAIVGASLTDILAKRNMKPEVRKGLRDQAIKAAKEQKKATRAAKKPEKVAPAKAKAAPKAKAAKITQKAAPRVGGKR* |
| ORF Type | complete |
| Blastp | 60S ribosomal protein L24 from Spodoptera with 82.05% of identity |
|---|---|
| Blastx | 60S ribosomal protein L24 from Spodoptera with 84.91% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003590400.1) |
| Pfam | Ribosomal protein L24e (PF01246.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer