Transcript | Ll_transcript_392763 |
---|---|
CDS coordinates | 288-641 (+) |
Peptide sequence | MEGTGGSSASAAAPVNQWLLEFSRRFQHYLDKSTPHSTYRWIGTVGIASIYVLRVFYLQGFYIVSYGLGIYLLNLLIGFLSPLVDPELEPSDGPTLPTKGSDEFKPFIRRLPEFKFW* |
ORF Type | complete |
Blastp | Protein RER1B from Arabidopsis with 73.5% of identity |
---|---|
Blastx | Protein RER1B from Arabidopsis with 80.77% of identity |
Eggnog | RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)(COG5249) |
Kegg | Link to kegg annotations (AT2G21600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413892.1) |
Pfam | Rer1 family (PF03248.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer