Transcript | Ll_transcript_393446 |
---|---|
CDS coordinates | 1489-1803 (+) |
Peptide sequence | MGRGVSSGGGQSSLGYLFGSGEAPNNAQGSNNQGQPENGVHAQNPSGASQPISTNQGQTANGSHAQNASGSSPIDKGIPAGIPGNLKNNYHRADGQNCGNFITV* |
ORF Type | complete |
Blastp | Protein SPIRAL1-like 1 from Arabidopsis with 52.43% of identity |
---|---|
Blastx | - |
Eggnog | in maintaining the cortical microtubules organization essential for anisotropic cell growth(ENOG410XU77) |
Kegg | Link to kegg annotations (AT1G26355) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442747.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer