| Transcript | Ll_transcript_393449 |
|---|---|
| CDS coordinates | 90-404 (+) |
| Peptide sequence | MGRGVSSGGGQSSLGYLFGSGEAPNNAQGSNNQGQPENGVHAQNPSGASQPISTNQGQTANGSHAQNASGSSPIDKGIPAGIPGNLKNNYHRADGQNCGNFITV* |
| ORF Type | complete |
| Blastp | Protein SPIRAL1-like 1 from Arabidopsis with 52.43% of identity |
|---|---|
| Blastx | - |
| Eggnog | in maintaining the cortical microtubules organization essential for anisotropic cell growth(ENOG410XU77) |
| Kegg | Link to kegg annotations (AT1G26355) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442747.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer