Protein coding transcript 18907

• Transcript: Ll_transcript_393450
• CDS coordinates: 480-869 (+)
• Peptide sequence: MGRGVSSGGGQSSLGYLFGSGEAPNNAQGSNNQGQPENGVHAQNPSGASQPISTNQGQTANGSHAQNASGSSPIDKGIPAGIPGNLKNNYHRADGQNCGNFITDRPSTKVHAAPGGGSSLGYLFGDSRK*
• ORF Type: complete

Annotations of Ll_transcript_393450

• Blastp: Protein SPIRAL1-like 1 from Arabidopsis with 60% of identity
• Blastx: Protein SPIRAL1-like 2 from Oryza sativa with 82% of identity
• Eggnog: in maintaining the cortical microtubules organization essential for anisotropic cell growth(ENOG410XU77)
• Kegg: Link to kegg annotations (AT1G26355)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442747.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;