Protein coding transcript 1891

• Transcript: Ll_transcript_276037
• CDS coordinates: 2-979 (+)
• Peptide sequence: NTNHVLPSSSNDRNKNPMMVPAPKESIPMFSPTYYAACSFGGIFSCGLTHMTVTPLDLVKCNMQIDPQKYKSITSGFGVLFKEQGARGFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDLAGAENAVKYKTFIYLAGSASAEVIADIALCPMEAVKVRVQTQPGFARGLADGFPKFVKAEGAGGLYKGLVPLWGRQIPYTMMKFASFETIVEMIYKYAIPTPKEQCSKNKQLGVSFAAGYAAGVLCAIVSHPADNLVSFLNNAKGATVADAVKKIGLLGLFTRGLPLRIVMIGTLTGAQWGLYDSFKVYVGLPTTGGSAPAPIK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_276037

• Blastp: Mitochondrial phosphate carrier protein 3, mitochondrial from Arabidopsis with 85.38% of identity
• Blastx: Mitochondrial phosphate carrier protein 3, mitochondrial from Arabidopsis with 85.38% of identity
• Eggnog: Phosphate carrier protein(ENOG410XPST)
• Kegg: Link to kegg annotations (AT5G14040)
• CantataDB: Link to cantataDB annotations (CNT0000127)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463184.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;