Protein coding transcript 189104

• Transcript: Ll_transcript_92353
• CDS coordinates: 3228-4025 (+)
• Peptide sequence: MYAISLDMKHLHELNNDHPLAGGLLSFENEKDAVEEWQPSALREKRFRKPTKRYIEESSNLRSKEKIPIAATKSKNLTLSSFDELNVRPKALGKIPGEKYRNENSDVTLPALKVCRGRPKKKKLENDKEPLTSESEDEPKRKDRRKNQRMWTLPEVKKLVDGISEYGIGRWTNIKRFFFSSSSYRTPTDIRDKWRNLLRASSAQKSSDKEAEQNDELALRPLPVELVQRVRELAKIHPYPRARGSKKSCVSSSLGKRNLKRKRCS*
• ORF Type: complete

Annotations of Ll_transcript_92353

• Blastp: Telomere repeat-binding protein 4 from Arabidopsis with 29.79% of identity
• Blastx: Telomere repeat-binding protein 4 from Arabidopsis with 29.79% of identity
• Eggnog: Telomere repeat-binding protein(ENOG4111C5T)
• Kegg: Link to kegg annotations (AT5G13820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460804.1)
• Pfam: Myb-like DNA-binding domain (PF13921.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;