Protein coding transcript 189119

• Transcript: Ll_transcript_92725
• CDS coordinates: 550-1038 (-)
• Peptide sequence: MQRYDPDPAAKAAAATVLASKLGADSGLKVYVGDESNLGAATTKSNNAEIMQSTGLRNRRHVQSRSTSPGTTTPNYSDRQLLGSGGTDQTNTSDHNQLLVVEHQQPQGSTTQDGGWIARFAALLVGEDPTQSYALICGNCHMHNGKWAEFDVLCFYPFPFTA*
• ORF Type: complete

Annotations of Ll_transcript_92725

• Blastp: Uncharacterized protein At2g24330 from Arabidopsis with 56.33% of identity
• Blastx: Uncharacterized protein At2g24330 from Arabidopsis with 55.15% of identity
• Eggnog: kiaa1715(ENOG4111I2R)
• Kegg: Link to kegg annotations (AT2G24330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415260.1)
• Pfam: Predicted integral membrane zinc-ribbon metal-binding protein (PF10058.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;