Protein coding transcript 189135

• Transcript: Ll_transcript_93334
• CDS coordinates: 1205-1687 (+)
• Peptide sequence: MVYTHAALCESMRLYPPVPAGRKEASNDDVLPDGTFVKKGTGVVFHTYTMGRSEKIWGPDWAEFRPERWLNRVQEDDKWKFKGVDPFTYPVFLAGPRVCLGKEMAFLQMKTMVAGIMRQFKVVPVVANGAEPEYTSALTSLVKGGLHVRIEARSVTKTHY*
• ORF Type: complete

Annotations of Ll_transcript_93334

• Blastp: Cytochrome P450 94A2 from Vicia with 70.13% of identity
• Blastx: Cytochrome P450 94A2 from Vicia with 63.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAG33645)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428624.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;